All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,876)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (189,995)
- (288,104)
- (1)
- (19)
- (798)
- (1)
- (12,214)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,001)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,038)
- (3,903)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,767)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,865)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,594)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,111)
- (31,228)
- (221)
- (8)
- (23)
- (597,679)
- (16)
- (1)
- (800,229)
- (84,197)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,697)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,499)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,414)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,181)
- (153,811)
- (191)
- (53)
- (197,229)
- (502,585)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,528)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,657)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,436)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,642)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,888)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,100)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,680)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,997)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,363)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,252)
- (532)
- (4)
- (10)
- (2)
- (338,674)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,929)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
Invitrogen™ TNFAIP3 Recombinant Rabbit Monoclonal Antibody (SN07-31)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | P21580, Q60769 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | TNFAIP3 |
| Gene Symbols | TNFAIP3 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | A20; A20p37; A20p50; AISBL; OTU domain-containing protein 7C; OTUD7C; Putative DNA-binding protein A20; RP11-356I2.3; TNF alpha induced protein 3; TNF alpha-induced protein 3; TNFA1P2; TNFAIP3; TNFAIP3 (A20); Tnfip3; Tumor necrosis factor alpha-induced protein 3; tumor necrosis factor induced protein 3; tumor necrosis factor inducible protein A20; tumor necrosis factor, alpha induced protein 3; tumor necrosis factor, alpha-induced protein 3; zinc finger protein A20 |
| Gene | TNFAIP3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 21929, 7128 |
| Formulation | TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within Human TNFAIP3 aa 491-540. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SN07-31 |
Invitrogen™ HTR2A Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P14842, P28223 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | HTR2A |
| Gene Symbols | Htr2a |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A |
| Gene | Htr2a |
| Product Type | Antibody |
| Gene ID (Entrez) | 29595, 3356 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) . |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ HIF1A Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Rabbit,Bovine |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O35800, Q16665, Q61221, Q9XTA5 |
| Isotype | IgG |
| Concentration | 1.47 mg/mL |
| Antigen | HIF1A |
| Gene Symbols | HIF1A |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AA959795; ARNT interacting protein; ARNT2; ARNT-interacting protein; Basic-helix-loop-helix-PAS protein MOP1; bHLHe78; Class E basic helix-loop-helix protein 78; HIF; hif 1; hif 1a; HIF1; HIF1 alpha; HIF-1 alpha; HIF1a; hif-1a; hif1a.L; HIF1alpha; HIF-1alpha; HIF-1-alpha; HIF1-alpha; HIF1-alpha protein; hypoxia inducible factor 1 alpha; hypoxia inducible factor 1 alpha subunit; hypoxia inducible factor 1 alpha subunit L homeolog; hypoxia inducible factor 1 subunit alpha; hypoxia inducible factor 1 subunit alpha L homeolog; hypoxia inducible factor 1, alpha subunit; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia inducible factor-1 alpha; hypoxia-inducible factor 1 alpha; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1 alpha subunit; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) L homeolog; hypoxia-inducible factor 1-alpha; hypoxia-inducible factor-1 alpha; hypoxia-inducible factor1alpha; member of PAS protein 1; member of PAS superfamily 1; MOP1; PAS domain-containing protein 8; PASD8; XELAEV_18039792mg; XELAEV_18041137mg; xhif1a |
| Gene | HIF1A |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009579, 15251, 281814, 29560, 3091 |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the C-terminus region of human HIF1 alpha. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ SOX2 Monoclonal Antibody (20G5), DyLight™ 650
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C, do not freeze |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | DyLight 650 |
| Applications | Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P48431, P48432 |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | SOX2 |
| Gene Symbols | SOX2 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | ANOP3; cb236; Delta EF2a; lcc; MCOPS3; MCOPS3 (Microphthalmia Syndromic type 3); RGD1565646; sex determining region Y-box 2; SOX 2; SOX2; Sox-2; soxp; SRY (sex determining region Y) box 2; SRY (sex determining region Y)-box 2; SRY box 2; SRY related HMG box 2; SRY-box 2; SRY-box 2; SOX2; SRY-box containing gene 2; SRY-box transcription factor 2; SRY-related HMG-box gene 2; transcription factor SOX2; transcription factor SOX-2; wu:fb83g04; wu:fc14d07; ysb; zgc:65860; zgc:77389 |
| Gene | SOX2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 20674, 6657 |
| Formulation | PBS with proprietary stabilizer and 0.02% sodium azide |
| Immunogen | Full-length human recombinant protein expressed in bacteria. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 20G5 |
Invitrogen™ CD294 (CRTH2) Monoclonal Antibody (BM16), eFluor™ 660, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Rat |
| Conjugate | eFluor 660 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | Q9Y5Y4 |
| Isotype | IgG2a κ |
| Concentration | 5 μL/Test |
| Antigen | CD294 (CRTH2) |
| Gene Symbols | PTGDR2 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD294; chemoattractant receptor homologous molecule expressed on T helper type 2 cells; chemoattractant receptor-homologous molecule expressed on TH2 cells; CRTH2; DL1R; DP2; G protein-coupled receptor 44; Gpr44; G-protein coupled receptor 44; Grp45; MGC130436; PGD2 receptor; prostaglandin D2 receptor 2; prostaglandin D2 receptor CRTH2; Ptgdr2; putative G-protein coupled receptor 44 |
| Gene | PTGDR2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11251 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | BM16 |
Invitrogen™ CEA Monoclonal Antibody (1106)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunoprecipitation,Radioimmune Assays (RIA),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P06731 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | CEA |
| Gene Symbols | Ceacam5 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 1600029H12Rik; Carcinoembryonic antigen; carcinoembryonic antigen related cell adhesion molecule 5; carcinoembryonic antigen-related cell adhesion molecule 5; CD66e; CEA; CEACAM5; Meconium antigen 100; OTTHUMP00000199033; pregnancy-specific glycoprotein 30; Psg30; sCD66e; soluble CD66e |
| Gene | Ceacam5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1048 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4 |
| Immunogen | Purified CEA from pooled tumors. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 1106 |
Invitrogen™ MHC Class II (I-A/I-E) Monoclonal Antibody (M5/114.15.2), Super Bright™ 436, eBioscience™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Super Bright 436 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P01910, P01921, P04227, P04228, P04230, P06342, P06343, P06344, P06345, P06346, P14434, P14435, P14436, P14437, P14438, P14483, P23150 |
| Isotype | IgG2b κ |
| Concentration | 0.2 mg/mL |
| Antigen | MHC Class II (I-A/I-E) |
| Gene Symbols | H2-Aa, H2-Ab1, H2-Eb1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Abeta; AI323765; AI845868; cell surface glycoprotein; E-alpha-f; H-2 class II histocompatibility antigen, A beta chain; H-2 class II histocompatibility antigen, E-D alpha chain; H-2 class II histocompatibility antigen, E-K alpha chain; H-2 class II histocompatibility antigen, E-U alpha chain; H-2 class II histocompatibility antigen, I-E beta chain; H-2Ab; H2-Ab; H2-Ab1; H-2Ea; H2-Ea; H2-Ea-ps; H2Eb; H-2Eb; H2-Eb1; H2-iabeta; H2-IE-alpha; histocompatibility 2, class II antigen A, beta 1; histocompatibility 2, class II antigen E alpha; histocompatibility 2, class II antigen E alpha, pseudogene; histocompatibility 2, class II antigen E beta; Ia2; Ia-2; Ia3; Ia-3; Ia4; Ia-4; IAb; I-Ab; I-Abeta; I-Ad; I-Aq; I-E alpha MHC class II; I-E beta MHC class II; I-Ealpha; I-Ed; I-Ek; major histocompatibility complex class II beta chain; major histocompatibility complex H-2E beta chain; MHC class 2; MHC class II antigen A beta; MHC class II antigen E alpha; MHC class II H2-IA-beta-psi; MHC class II IE-b; MHC class II protein; MHC H2-IE-beta cell surface glycoprotein; response to metastatic cancers 1; Rmcs1 |
| Gene | H2-Aa |
| Product Type | Antibody |
| Gene ID (Entrez) | 14960, 14961, 14969 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | M5/114.15.2 |
Invitrogen™ Chorionic Gonadotropin Monoclonal Antibody (FB12), eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P01215, P0DN86 |
| Isotype | IgG1 κ |
| Concentration | 0.5 mg/mL |
| Antigen | Chorionic Gonadotropin |
| Gene Symbols | CGA, CGB3, CGB5, CGB8 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | anterior pituitary glycoprotein hormones common subunit alpha; CGA; CG-alpha; CGB; CGB3; CGB5; CGB7; CGB8; CG-beta; Choriogonadotropin alpha chain; choriogonadotropin subunit beta; Choriogonadotropin subunit beta 3; chorionic gonadotrophin chain beta; chorionic gonadotrophin subunit alpha; chorionic gonadotropin beta 3 subunit; chorionic gonadotropin beta 5 subunit; chorionic gonadotropin beta 8 subunit; chorionic gonadotropin beta chain; chorionic gonadotropin beta subunit; chorionic gonadotropin beta subunit 3; chorionic gonadotropin beta subunit 5; chorionic gonadotropin beta subunit 8; chorionic gonadotropin chain beta; chorionic gonadotropin human; chorionic gonadotropin, alpha polypeptide; chorionic gonadotropin, beta polypeptide; chorionic gonadotropin, beta polypeptide 5; chorionic gonadotropin, beta polypeptide 8; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin alpha chain; FSHA; FSH-alpha; Glycoprotein hormones alpha chain; glycoprotein hormones, alpha polypeptide; GPHa; GPHA1; HCG; hCGB; human chorionic gonadotropin; LHA; LSH-alpha; luteinizing hormone alpha chain; Lutropin alpha chain; thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain; TSHA; TSH-alpha |
| Gene | CGB3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1081, 1082, 93659, 94115 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FB12 |
Invitrogen™ S100A8 Monoclonal Antibody (CF-145), eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P05109 |
| Isotype | IgG2b κ |
| Concentration | 0.5 mg/mL |
| Antigen | S100A8 |
| Gene Symbols | S100A8 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 60B8AG; AI323541; B8Ag; CAGA; CAGB; calgranulin A; calgranulin B; calgranulin-A; Calgranulin-B; calprotectin L1H subunit; Calprotectin L1L subunit; CFAg; CGLA; CGLB; chemotactic cytokine CP-10; chemotactic S100 protein; CP-10; Cystic fibrosis antigen; L1Ag; leukocyte L1 complex heavy chain; Leukocyte L1 complex light chain; LIAG; MA387; MAC387; MIF; Migration inhibitory factor-related protein 14; migration inhibitory factor-related protein 8; MRP14; MRP-14; MRP8; MRP-8; NIF; P14; p8; Pro-inflammatory S100 cytokine; protein S100-A8; Protein S100-A9; S100 A8; S100 calcium binding protein A8; S100 calcium binding protein A8 (calgranulin A); S100 calcium binding protein A9; S100 calcium-binding protein A8; S100 calcium-binding protein A8 (calgranulin A); S100 calcium-binding protein A9; S100 calcium-binding protein A9 (calgranulin B); S100A8; S100A9; Urinary stone protein band A |
| Gene | S100A8 |
| Product Type | Antibody |
| Gene ID (Entrez) | 6279 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | CF-145 |
Invitrogen™ Lysozyme Recombinant Rabbit Monoclonal Antibody (ST50-02)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot,Western Blot |
| Form | Liquid |
| Gene Accession No. | P08905, P17897, P61626 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Lysozyme |
| Gene Symbols | LYZ, Lyz1, Lyz2 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 1,4-beta-N-acetylmuramidase C; 1700038F02Rik; 4-beta-N-acetylmuramidase C; AI326280; Allergen Gal d IV; bA534G20.1; c-type lysozyme; dystrophin; egg white lysozyme; Gal d 4; KAAG648; LYC2; Lys; Lysm; lysozyme; lysozyme (renal amyloidosis); lysozyme 1; lysozyme 2; lysozyme C; Lysozyme C type M; lysozyme C type P; Lysozyme C, spleen isozyme; lysozyme C-1; Lysozyme C-2; lysozyme C-3; lysozyme d1; lysozyme F1; lysozyme like 1; lysozyme-like 1; lysozyme-like protein 1; lysozyme-like protein 2; Lysz; LYZ; Lyz1; Lyz2; LYZC; LYZD1; LYZF1; LYZL1; Lyzs; Lzm; Lzm-s1; Lzp; Lzp-s; P lysozyme structural; PRO1278; renal amyloidosis; RGD1559869; unnamed protein product; UNQ648/PRO1278 |
| Gene | LYZ |
| Product Type | Antibody |
| Gene ID (Entrez) | 17105, 17110, 4069 |
| Formulation | TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within Human Lysozyme C aa 36-85. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | ST50-02 |
Invitrogen™ Human Serum Albumin Monoclonal Antibody (1E1)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Radioimmune Assays (RIA) |
| Form | Liquid |
| Gene Accession No. | P02768 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | Human Serum Albumin |
| Gene Symbols | ALB |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | Alb; Alb1; Alb-1; albumin; albumin (32 AA); albumin (AA 34); albumin 1; Albza; ANALBA; cell growth inhibiting protein 42; DKFZp779N1935; FDAH; GIG20; GIG42; growth-inhibiting protein 20; PRO0883; PRO0903; PRO1341; PRO1708; PRO2044; PRO2619; PRO2675; Serum albumin; UNQ696/PRO1341 |
| Gene | ALB |
| Product Type | Antibody |
| Gene ID (Entrez) | 213 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4 |
| Immunogen | Human Serum Albumin. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 1E1 |
CD49b (Integrin alpha 2) Monoclonal Antibody (DX5), PE-Cyanine5.5, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | PE-Cyanine5.5 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgM κ |
| Gene Accession No. | Q62469 |
| Concentration | 0.2 mg/mL |
| Antigen | CD49b (Integrin alpha 2) |
| Gene Symbols | Itga2 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | alpha 2 subunit of VLA-2 receptor; BDPLT9; BR; CD49 antigen-like family member B; CD49B; Collagen receptor; DX5; GPIa; HPA-5; human platelet alloantigen system 5; integrin alpha 2; integrin alpha-2; integrin subunit alpha 2; integrin, alpha 2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); Itga2; platelet antigen Br; platelet glycoprotein GPIa; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; VLA-2; VLA2 receptor; VLA-2 receptor, alpha 2 subunit; VLA-2 subunit alpha; VLAA2 |
| Gene | Itga2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 16398 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | DX5 |
TNF alpha Monoclonal Antibody (TN3-19.12), Functional Grade, eBioscience™, Invitrogen™
Armenian Hamster Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Armenian Hamster |
| Conjugate | Functional Grade |
| Applications | Functional Assay,Neutralization |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | P06804, P16599 |
| Concentration | 1 mg/mL |
| Antigen | TNF alpha |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | Tnf |
| Product Type | Antibody |
| Gene ID (Entrez) | 21926, 24835 |
| Formulation | PBS with no preservative; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | TN3-19.12 |
CD10 Monoclonal Antibody (eBioCB-CALLA (CB-CALLA)), Super Bright™ 436, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Super Bright 436 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Gene Accession No. | P08473 |
| Concentration | 5 μL/Test |
| Antigen | CD10 |
| Gene Symbols | Mme |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 6030454K05Rik; Atriopeptidase; C85356; CALLA; CD10; CMT2T; common acute lymphoblastic leukemia antigen; common acute lymphocytic leukemia antigen; Enkephalinase; EPN; membrane metallo endopeptidase; membrane metalloendopeptidase; membrane metallo-endopeptidase; membrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10); membrane metallo-endopeptidase (neutral endopeptidase/enkephalinase); membrane metallo-endopeptidase variant 1; membrane metallo-endopeptidase variant 2; MME; NEP; neprilysin; neprilysin-390; neprilysin-411; neutral endopeptidase 24.11; SFE; Skin fibroblast elastase |
| Gene | Mme |
| Product Type | Antibody |
| Gene ID (Entrez) | 4311 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eBioCB-CALLA (CB-CALLA) |
CD314 (NKG2D) Monoclonal Antibody (CX5), Super Bright™ 436, eBioscience™, Invitrogen™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Super Bright 436 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | O54709 |
| Concentration | 0.2 mg/mL |
| Antigen | CD314 (NKG2D) |
| Gene Symbols | Klrk1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD314; D12S2489E; D6H12S2489E; killer cell lectin like receptor K1; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; KLR; Klrk1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; Nkg2d; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; Nkrp2; NKR-P2; NKR-P2, ortholog of human NKG2D |
| Gene | Klrk1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 27007 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | CX5 |